Skip to product information
1 of 1

Gene Bio Systems

Recombinant Botryotinia fuckeliana Protein get1(get1)

Recombinant Botryotinia fuckeliana Protein get1(get1)

SKU:CSB-CF413225BVD

Regular price ¥278,900 JPY
Regular price Sale price ¥278,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Botryotinia fuckeliana (strain B05.10) (Noble rot fungus) (Botrytis cinerea)

Uniprot NO.:A6RUY7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPSLLFTCFLVQLLIHLVNTFGADAINNLLWNLYNMFPTPTSQSAGEQKKLKREFMKVRH EMNATSSQDEFAKWAKLRRQHDKLFDQLEKSKSSLDSTKSTFDSSVSTLRWLGTNGLRML LQFWFSKQAMFWLPKGWFPYYAEWLLSFPRAPLGSISIQAWTLACAAVILLVSDALVAVV ALALGTQTGAKAKKMEEPMKAGGQGTEKPGKKEL

Protein Names:Recommended name: Protein get1 Alternative name(s): Guided entry of tail-anchored proteins 1

Gene Names:Name:get1 ORF Names:BC1G_04578

Expression Region:1-214

Sequence Info:full length protein

View full details