Gene Bio Systems
Recombinant Bordetella petrii UPF0060 membrane protein Bpet0062 (Bpet0062)
Recombinant Bordetella petrii UPF0060 membrane protein Bpet0062 (Bpet0062)
SKU:CSB-CF434492BPB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Uniprot NO.:A9HVV4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MPLLHTLGLFALTAVAEIVGCYLPYLWLKQGHSAWLLVPAALSLAVFAWLLTLHPTASGR VYAAYGGVYVSMALLWLWAVDGVRPATTDWAGVGLCLAGMALIMAGPRHG
Protein Names:Recommended name: UPF0060 membrane protein Bpet0062
Gene Names:Ordered Locus Names:Bpet0062
Expression Region:1-110
Sequence Info:full length protein
