Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bordetella petrii UPF0060 membrane protein Bpet0062 (Bpet0062)

Recombinant Bordetella petrii UPF0060 membrane protein Bpet0062 (Bpet0062)

SKU:CSB-CF434492BPB

Regular price ¥260,400 JPY
Regular price Sale price ¥260,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)

Uniprot NO.:A9HVV4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPLLHTLGLFALTAVAEIVGCYLPYLWLKQGHSAWLLVPAALSLAVFAWLLTLHPTASGR VYAAYGGVYVSMALLWLWAVDGVRPATTDWAGVGLCLAGMALIMAGPRHG

Protein Names:Recommended name: UPF0060 membrane protein Bpet0062

Gene Names:Ordered Locus Names:Bpet0062

Expression Region:1-110

Sequence Info:full length protein

View full details