Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bordetella pertussis Protein CrcB homolog(crcB)

Recombinant Bordetella pertussis Protein CrcB homolog(crcB)

SKU:CSB-CF753097BUA

Regular price ¥262,900 JPY
Regular price Sale price ¥262,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

Uniprot NO.:Q7VYU0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLTYAPLNFIAIGIGATLGAWLRWVLGLRLNGAGWPWGTLTANLVGGYLIGVMVALIASH PEWPAWIRLAAVTGFLGGLTTFSTFSAETVDMLERGVYATAAAYAGASLAGSLAMTGLGL ATVRLLLR

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:BP1217

Expression Region:1-128

Sequence Info:full length protein

View full details