Gene Bio Systems
Recombinant Bordetella bronchiseptica Type IV secretion system protein ptlA homolog(ptlA)
Recombinant Bordetella bronchiseptica Type IV secretion system protein ptlA homolog(ptlA)
SKU:CSB-CF767041BTY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) (Alcaligenes bronchisepticus)
Uniprot NO.:Q7WDU3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:QASGGLQRVNSFMAGIVTVLRGASVATVTIAIIWAGYKLLFRHADVLDVVRVVLAGLLIG ASAEIARYLLT
Protein Names:Recommended name: Type IV secretion system protein ptlA homolog
Gene Names:Name:ptlA Ordered Locus Names:BB4895
Expression Region:32-102
Sequence Info:full length protein
