Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bifidobacterium adolescentis UPF0059 membrane protein BAD_1445 (BAD_1445)

Recombinant Bifidobacterium adolescentis UPF0059 membrane protein BAD_1445 (BAD_1445)

SKU:CSB-CF371675BOX

Regular price ¥270,900 JPY
Regular price Sale price ¥270,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)

Uniprot NO.:A1A3E3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLIQILLIGVSVSMDTFAVSIGKGLTVKKLRGLDALKTALWFGGFQALFPLLGYFAASTF SKYVTAVDHWIIFGLLALIGGNMVREAFEEDEENAKETPEFDWKHMLPLAVACSIDAVAV GVSFAFMTLNIWLSVVIIGITTGLFSAAGLYIGRVFGSRWQKPAQIAGGVVLILIGLKVL FEHLGFLG

Protein Names:Recommended name: UPF0059 membrane protein BAD_1445

Gene Names:Ordered Locus Names:BAD_1445

Expression Region:1-188

Sequence Info:full length protein

View full details