Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bdellovibrio bacteriovorus ATP synthase subunit a(atpB)

Recombinant Bdellovibrio bacteriovorus ATP synthase subunit a(atpB)

SKU:CSB-CF761096BFP

Regular price ¥272,900 JPY
Regular price Sale price ¥272,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100)

Uniprot NO.:Q6MRR3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFNWTQLVPGVGHEYAHVATLGIATVAAVGIGAAARASLGKGEAAVLPASKFSLRGIFE LLTEMTSGLADMVIGEHGKHYIPFFASVFFFILFNNLLGMIPGMTPATENMNTTFGFGVL MFLFYNFQGVKENGPVAYLKHFMGPVIFLAPLMFVIEIVSHIVRPFSLGLRLANVMMGDH TVLSVFLDLVPIGVPIPFYVMGLFVCFVQAFVFTLLSMVYVAFAIAHDH

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6

Gene Names:Name:atpB Ordered Locus Names:Bd0009

Expression Region:1-229

Sequence Info:full length protein

View full details