Recombinant Bat coronavirus Rp3-2004 Envelope small membrane protein(E)

SKU: CSB-CF665606BFE

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bat coronavirus Rp3/2004 (BtCoV/Rp3/2004) (SARS-like coronavirus Rp3)

Uniprot NO.:Q3I5J3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPTVYVYS RVKNLNSSEGVPDLLV

Protein Names:Recommended name: Envelope small membrane protein Short name= E protein Short name= sM protein

Gene Names:Name:E Synonyms:sM ORF Names:4

Expression Region:1-76

Sequence Info:full length protein