Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bartonella quintana Type IV secretion system protein virB2(virB2)

Recombinant Bartonella quintana Type IV secretion system protein virB2(virB2)

SKU:CSB-CF810510BSH

Regular price ¥252,600 JPY
Regular price Sale price ¥252,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bartonella quintana (strain Toulouse) (Rochalimaea quintana)

Uniprot NO.:Q8KQC3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ANSASSLGNVDSVLQNIVTMMTGTTAKLIAIICVAAVGIGWMSGFIDLRKAAYCILGIGI VFGAPTLVSTLMGSS

Protein Names:Recommended name: Type IV secretion system protein virB2

Gene Names:Name:virB2 Ordered Locus Names:BQ10530

Expression Region:30-104

Sequence Info:full length protein

View full details