Skip to product information
1 of 1

Gene Bio Systems

Recombinant Barley stripe mosaic virus Movement protein TGB2

Recombinant Barley stripe mosaic virus Movement protein TGB2

SKU:CSB-CF361395BEM

Regular price ¥263,800 JPY
Regular price Sale price ¥263,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Barley stripe mosaic virus (BSMV)

Uniprot NO.:P04869

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKTTVGSRPNKYWPIVAGIGVVGLFAYLIFSNQKHSTESGDNIHKFANGGSYRDGSKSIS YNRNHPFAYGNASSPGMLLPAMLTIIGIISYLWRTRDSVLGDSGGNNSCGEDCQGECLNG HSRRSLLCDIG

Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): 14 kDa protein Beta-D protein Triple gene block 2 protein Short name= TGBp2 Cleaved into the following chain: 1. TGB2' protein

Gene Names:

Expression Region:1-131

Sequence Info:full length protein

View full details