Recombinant Barbarea verna  NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic

Recombinant Barbarea verna NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic

CSB-CF390567BOQ
Regular price
¥168,400 JPY
Sale price
¥168,400 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Barbarea verna (Land cress) (Early yellowrocket)

Uniprot NO.:A4QKB0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFLLYEYDIFWAFLIISSAIPVLAFFISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEWS

Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 3 NADH-plastoquinone oxidoreductase subunit 3

Gene Names:Name:ndhC

Expression Region:1-120

Sequence Info:full length protein

Your list is ready to share