Recombinant Banana bunchy top virus  Movement and RNA silencing protein(DNA-M)

Recombinant Banana bunchy top virus Movement and RNA silencing protein(DNA-M)

CSB-CF717646BEH
Regular price
¥167,700 JPY
Sale price
¥167,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Banana bunchy top virus (isolate Autralia) (BBTV)

Uniprot NO.:Q65387

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALTTERVKLFFEWFLFFGAIFIAITILYILLVLLFEVPRYIKELVRCLVEYLTRRRVWM QRTQLTEATGDVEIGRGIVEDRRDQEPAVIPHVSQVIPSQPNRRDDQGRRGNAGPMF

Protein Names:Recommended name: Movement and RNA silencing protein Short name= MP

Gene Names:Name:DNA-M Synonyms:C4

Expression Region:1-117

Sequence Info:full length protein

Your list is ready to share