Gene Bio Systems
Recombinant Bacteroides thetaiotaomicron Protein CrcB homolog(crcB)
Recombinant Bacteroides thetaiotaomicron Protein CrcB homolog(crcB)
SKU:CSB-CF807251BDU
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)
Uniprot NO.:Q89Z03
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLKTLLFIGMGSFTGGVLRYLISRYVQNFLTPSFPLGTLLVNVLGCFAIGLFYGLFERGN LMNPNLRMFLTVGFCGGFTTFSTFMNENFQLIKDDNFFYLSLYVGLSLFVGFIMLYLGYS LVKQ
Protein Names:Recommended name: Protein CrcB homolog
Gene Names:Name:crcB Ordered Locus Names:BT_4574
Expression Region:1-124
Sequence Info:full length protein
