Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacteroides fragilis UPF0059 membrane protein BF1149(BF1149)

Recombinant Bacteroides fragilis UPF0059 membrane protein BF1149(BF1149)

SKU:CSB-CF692410BAAB

Regular price ¥271,600 JPY
Regular price Sale price ¥271,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacteroides fragilis (strain ATCC 25285 / NCTC 9343)

Uniprot NO.:Q5LG69

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTGLEIWLLAIGLAMDCLAVSIASGIILRRIQWRPMLIMAFFFGLFQAIMPLLGWLGAST FSHLIESVDHWIAFAILAFLGGRMIKESFKEEDCCQRFNPASLKVVITMAVATSIDALAV GVSFAFLGIKSCSSILYPAGIIGFVSFFMSLIGLIFGIRFGCGIARKLRAELWGGIILIL IGTKILIEHLFFNN

Protein Names:Recommended name: UPF0059 membrane protein BF1149

Gene Names:Ordered Locus Names:BF1149

Expression Region:1-194

Sequence Info:full length protein

View full details