Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus weihenstephanensis UPF0316 protein BcerKBAB4_3093 (BcerKBAB4_3093)

Recombinant Bacillus weihenstephanensis UPF0316 protein BcerKBAB4_3093 (BcerKBAB4_3093)

SKU:CSB-CF431531BON

Regular price ¥274,300 JPY
Regular price Sale price ¥274,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus weihenstephanensis (strain KBAB4)

Uniprot NO.:A9VM05

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLQALLIFVLQIIYVPTLTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSAGLLLGGYIENKLAIGYITYQVSLLDRCNELVNELRHFGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINEIAPKAFMSSYEIRSFKGGYLTKAMKKRALLKKKKDE HAL

Protein Names:Recommended name: UPF0316 protein BcerKBAB4_3093

Gene Names:Ordered Locus Names:BcerKBAB4_3093

Expression Region:1-183

Sequence Info:full length protein

View full details