Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus thuringiensis subsp. morrisoni Pesticidal crystal protein cry1Fb(cry1Fb),partial

Recombinant Bacillus thuringiensis subsp. morrisoni Pesticidal crystal protein cry1Fb(cry1Fb),partial

SKU:CSB-EP528987BRS

Regular price ¥190,600 JPY
Regular price Sale price ¥190,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O66377

Gene Names: cry1Fb

Organism: Bacillus thuringiensis subsp. morrisoni

AA Sequence: VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE

Expression Region: 984-1169aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 47.8 kDa

Alternative Name(s): 132KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIF(b)

Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.

Reference: A novel cry1Fb gene from Bacillus thuringiensis subsp. morrisoni.Song F., Zhang J., Ding Z., Chen Z., Li G., Huang D.Masuda K., Asano S.

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details