Gene Bio Systems
Recombinant Bacillus thuringiensis subsp. konkukian Protein psiE homolog(psiE)
Recombinant Bacillus thuringiensis subsp. konkukian Protein psiE homolog(psiE)
SKU:CSB-CF750251BAAE
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus thuringiensis subsp. konkukian (strain 97-27)
Uniprot NO.:Q6HBH8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKSFNIDHFIASVLQWILNIALIILSIVLSIFLINETITFIQYIFSAKKYTSYKLVESII VYFLYFEFIALIIKYFKSNYHFPLRYFIYIGITALIRLIIVSHEEPMETLLYAGAILVLV IALYISNMRDLRKE
Protein Names:Recommended name: Protein psiE homolog
Gene Names:Name:psiE Ordered Locus Names:BT9727_4789
Expression Region:1-134
Sequence Info:full length protein
