Gene Bio Systems
Recombinant Bacillus subtilis UPF0715 membrane protein ywlA(ywlA)
Recombinant Bacillus subtilis UPF0715 membrane protein ywlA(ywlA)
SKU:CSB-CF334525BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:P39150
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKYNYTVLLSAFTMSVLYSVIYIHSFIIAALITMAFYFLFPYLIFALPLQIMMNKKPKRF SPLYLLYYLAAAFIANAIIFGMLQPSGQSLFQNTAFYLFAVLTALIYWIWDSVLLQKKEA
Protein Names:Recommended name: UPF0715 membrane protein ywlA
Gene Names:Name:ywlA Ordered Locus Names:BSU36980 ORF Names:ipc-26r
Expression Region:1-120
Sequence Info:full length protein
