Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Uncharacterized protein yycQ(yycQ)

Recombinant Bacillus subtilis Uncharacterized protein yycQ(yycQ)

SKU:CSB-CF673812BRJ

Regular price ¥253,900 JPY
Regular price Sale price ¥253,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:Q45605

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGAIAVLFIVFGFPIVAGVFGIAGHFLFKRFWVAPLIVLITSLILLVTLASGNSSFIFWV VMYTAIALVTSVATLFLRKFFE

Protein Names:Recommended name: Uncharacterized protein yycQ

Gene Names:Name:yycQ Ordered Locus Names:BSU40260

Expression Region:1-82

Sequence Info:full length protein

View full details