Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Uncharacterized protein yvbI(yvbI)

Recombinant Bacillus subtilis Uncharacterized protein yvbI(yvbI)

SKU:CSB-CF516389BRJ

Regular price ¥281,800 JPY
Regular price Sale price ¥281,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O32246

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYCPQCGHQTDGGNFCEKCGSPLPGQSGHQHAAQTGAAAKQAAKQFGSFVLSVLKRPYQE CKATGGEQLISAIITMVLFSLLTPLMFYILFSDGPGSVSFTAIFLEPTIYFILFLFGLHA CIFFALKIAGNQVSFKDSFSRFGAFLIPFTAILILALFFFLLHTDICFTILAVGLIGAFF AIPPAMLSSYQHSYKGKVDFIYSTIVIYLIICVTFQLIIEHYVKEIFRYMLF

Protein Names:Recommended name: Uncharacterized protein yvbI

Gene Names:Name:yvbI Ordered Locus Names:BSU33870

Expression Region:1-232

Sequence Info:full length protein

View full details