Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Subtilosin-A(sboA)

Recombinant Bacillus subtilis Subtilosin-A(sboA)

SKU:CSB-EP522484BRJ

Regular price ¥222,400 JPY
Regular price Sale price ¥222,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Signal Transduction

Uniprot ID:O07623

Gene Names:sboA

Organism:Bacillus subtilis (strain 168)

AA Sequence:NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Expression Region:9-43aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:Tag-Free

MW:3.4 kDa

Alternative Name(s):Antilisterial bacteriocin subtilosin (sbo)

Relevance:Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium, A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood

Reference:"Subtilosin A, a new antibiotic peptide produced by Bacillus subtilis 168: isolation, structural analysis, and biogenesis." Babasaki K., Takao T., Shimonishi Y., Kurahashi K. J. Biochem. 98:585-603(1985)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Bacteriocin class V family

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bsu:BSU37350

STRING Database Link:https://string-db.org/network/224308.Bsubs1_010100020186

OMIM Database Link:

Lead Time Guidance:13-23 business days

View full details