
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:P28265
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWLPVLGLVLGIAIGLMTNLTIPSEYSNYLSLAVLAALDTLIGGIRAHLQGTYDEMVFVS GFFFNIILAISLAFLGVHLGVDLYLAGIFAFGVRLFQNIAVIRRNLLTKWTLSKKNKKNV I
Protein Names:Recommended name: Small basic protein
Gene Names:Name:sbp Ordered Locus Names:BSU15270
Expression Region:1-121
Sequence Info:full length protein
You may also like
-
Recombinant Bacillus subtilis Uncharacterized protein ypjA(ypjA)
- Regular price
- ¥178,600 JPY
- Sale price
- ¥178,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Spore maturation protein B(spmB)
- Regular price
- ¥177,800 JPY
- Sale price
- ¥177,800 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Protein CsbA(csbA)
- Regular price
- ¥165,200 JPY
- Sale price
- ¥165,200 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus subtilis Uncharacterized protein yqeD(yqeD)
- Regular price
- ¥181,500 JPY
- Sale price
- ¥181,500 JPY
- Regular price
-
- Unit price
- per
Sold out