Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase(tuaA)

Recombinant Bacillus subtilis Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase(tuaA)

SKU:CSB-CF516393BRJ

Regular price ¥273,600 JPY
Regular price Sale price ¥273,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O32274

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSAEKSMNVSREFSVQQIHSFTLSEKTARYLAIKRVMDIWFALIGLAIALPMIAVFSILI CLETPGPAIYTQERVGKGGKPFKLYKLRSMKIDAEKSGAVWAQKQDPRVTRIGAFIRRTR IDELPQLFNVLKGDMSMIGPRPERPVFTEKFQNEIPGFTQRLGSGERRLRYDAEGKADI

Protein Names:Recommended name: Putative undecaprenyl-phosphate N-acetylgalactosaminyl 1-phosphate transferase EC= 2.7.8.- Alternative name(s): Teichuronic acid biosynthesis protein TuaA UDP-GalNAc:undecaprenyl-P GalNAc 1-P transferase

Gene Names:Name:tuaA Synonyms:yvhA Ordered Locus Names:BSU35610

Expression Region:1-179

Sequence Info:full length protein

View full details