Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Putative lipid phosphate phosphatase yodM(yodM)

Recombinant Bacillus subtilis Putative lipid phosphate phosphatase yodM(yodM)

SKU:CSB-CF516476BRJ

Regular price ¥271,900 JPY
Regular price Sale price ¥271,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O34349

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DEAISKAAVLIRQPWLNEVMTGITHLGASSFLLPLIVIIGAGMFFYRKTWDGLLMLLVFG TDRLLNKVLKEWIERVRPDFAPLVHESSFSFPSGHSMNAACVYPVIAYFLVKHLPFLSKH KKMVYIIAGVIAVLVGISRVYLGVHFVTDVLGGFSLGLLLFFLVKGFDEKIKRFRQK

Protein Names:Recommended name: Putative lipid phosphate phosphatase yodM EC= 3.1.3.-

Gene Names:Name:yodM Ordered Locus Names:BSU19650

Expression Region:27-203

Sequence Info:full length protein

View full details