Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Putative HMP-thiamine permease protein ykoE(ykoE)

Recombinant Bacillus subtilis Putative HMP-thiamine permease protein ykoE(ykoE)

SKU:CSB-CF516535BRJ

Regular price ¥271,500 JPY
Regular price Sale price ¥271,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O34738

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKSWKVKEIVIMSVISIVFAVVYLLFTHFGNVLAGMFGPIAYEPIYGIWFIVSVIAAYMI RKPGAALVSEIIAALVECLLGNPSGPMVIVIGIVQGLGAEAVFLATRWKAYSLPVLMLAG MGSSVASFIYDLFVSGYAAYSPGYLLIMLVIRLISGALLAGLLGKAVSDSLAYTGVLNGM ALGKELKKKRKRASEHASL

Protein Names:Recommended name: Putative HMP/thiamine permease protein ykoE

Gene Names:Name:ykoE Ordered Locus Names:BSU13230

Expression Region:1-199

Sequence Info:full length protein

View full details