Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Probable biotin transporter BioY(bioY)

Recombinant Bacillus subtilis Probable biotin transporter BioY(bioY)

SKU:CSB-CF519205BRJ

Regular price ¥273,400 JPY
Regular price Sale price ¥273,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O07620

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKLIDMMHIAIFTALMAVLGFMPPLFLSFTPVPITLQTLGVMLAGSILRPKSAFLSQLV FLLLVAFGAPLLPGGRGGFGVFFGPSAGFLIAYPLASWLISLAANRLRKVTVLRLFFTHI VFGIIFIYLLGIPVQAFIMHIDLSQAAFMSLAYVPGDLIKAAVSAFLAIKITQALSLSDT MFTKGG

Protein Names:Recommended name: Probable biotin transporter BioY

Gene Names:Name:bioY Synonyms:yhfU Ordered Locus Names:BSU10370

Expression Region:1-186

Sequence Info:full length protein

View full details