Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus pumilus UPF0295 protein BPUM_0828 (BPUM_0828)

Recombinant Bacillus pumilus UPF0295 protein BPUM_0828 (BPUM_0828)

SKU:CSB-CF422366BOL

Regular price ¥226,000 JPY
Regular price Sale price ¥226,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus pumilus (strain SAFR-032)

Uniprot NO.:A8FB95

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKYSSKINKIRTFALSLVFVGFLIMYIGVFFKESIWLSTFFMLLGVLSIGLSTVVYFWI GMLSTKAVRVVCPGCEKETKVLGRVDMCMHCREPLTLDPGLEGKEFDESYNRKKS

Protein Names:Recommended name: UPF0295 protein BPUM_0828

Gene Names:Ordered Locus Names:BPUM_0828

Expression Region:1-115

Sequence Info:full length protein

View full details