Gene Bio Systems
Recombinant Bacillus halodurans UPF0316 protein BH0621(BH0621)
Recombinant Bacillus halodurans UPF0316 protein BH0621(BH0621)
SKU:CSB-CF888535BQS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Uniprot NO.:Q9KF65
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVSFFMEHALTMILIILIINVVYVTLFTVRMIFTLKNQRYLAATVSMIEIIVYVLGLSLV LDNLDRIENLIAYAVGYGIGVITGMKVEEKLALGYITVNVITKEYEPDIPNTLRDKGYGV TNWVAYGREGERLMMEILTSRKSEADLYATIKKLDPKAFIISHEPKTFFGGFWVKGIRR
Protein Names:Recommended name: UPF0316 protein BH0621
Gene Names:Ordered Locus Names:BH0621
Expression Region:1-179
Sequence Info:full length protein
