Recombinant Bacillus halodurans Spore morphogenesis and germination protein ywcE(ywcE)

SKU: CSB-CF873048BQS

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Uniprot NO.:Q9KB63

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLFFAYMLVASATPLFLWLEHRKIALTSIPFIIIMWVLALSHMFEGFLFDLHHSVFLTA FFVNVIIAHFAALVLYAYPHIRPKSRTFTESMD

Protein Names:Recommended name: Spore morphogenesis and germination protein ywcE

Gene Names:Name:ywcE Ordered Locus Names:BH2068

Expression Region:1-93

Sequence Info:full length protein