Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus halodurans ComG operon protein 3 homolog(comGC)

Recombinant Bacillus halodurans ComG operon protein 3 homolog(comGC)

SKU:CSB-CF862553BQS

Regular price ¥251,700 JPY
Regular price Sale price ¥251,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

Uniprot NO.:Q9K923

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:FTLVEMMIVLMIISILLLVALPSMTKNNEVAGDKGCEATVKLLQTQVHAYEIDHDRLPTN LDALKREGYVEHTECPNGKKLTLRNGVVAISE

Protein Names:Recommended name: ComG operon protein 3 homolog

Gene Names:Name:comGC Ordered Locus Names:BH2827

Expression Region:11-102

Sequence Info:full length protein

View full details