Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus UPF0756 membrane protein BCQ_4399 (BCQ_4399)

Recombinant Bacillus cereus UPF0756 membrane protein BCQ_4399 (BCQ_4399)

SKU:CSB-CF496718BQQ

Regular price ¥268,000 JPY
Regular price Sale price ¥268,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain Q1)

Uniprot NO.:B9J095

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISQSTLFLFILLIIGLIAKNQSLTVAIGVLFLLKFTFLGDKVFPYLQTKGINLGVTVIT IAVLVPIATGEIGFKQLGEAAKSYYAWIALASGVAVALLAKGGVQLLTTDPHITTALVFG TIIAVALFNGVAVGPLIGSGIAYAVMSIIQMFK

Protein Names:Recommended name: UPF0756 membrane protein BCQ_4399

Gene Names:Ordered Locus Names:BCQ_4399

Expression Region:1-153

Sequence Info:full length protein

View full details