Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus UPF0059 membrane protein BCB4264_A5447 (BCB4264_A5447)

Recombinant Bacillus cereus UPF0059 membrane protein BCB4264_A5447 (BCB4264_A5447)

SKU:CSB-CF467501BQO

Regular price ¥271,200 JPY
Regular price Sale price ¥271,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain B4264)

Uniprot NO.:B7HFM2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTFEQLIPLIIMAFALGMDAFSVSLGMGMMPLKLRQILYIGMTIGIFHIIMPFIGMVLGR FLSEKYGDIAHFAGAILLIGLGFYIVYSTILQNEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTIITILLFGFVSMLLAWIGLLIGRHAKDMLGTYGEIVGGIILVGFGLYILF PI

Protein Names:Recommended name: UPF0059 membrane protein BCB4264_A5447

Gene Names:Ordered Locus Names:BCB4264_A5447

Expression Region:1-182

Sequence Info:full length protein

View full details