Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus UPF0059 membrane protein BCAH187_A5502 (BCAH187_A5502)

Recombinant Bacillus cereus UPF0059 membrane protein BCAH187_A5502 (BCAH187_A5502)

SKU:CSB-CF467578BQL

Regular price ¥270,500 JPY
Regular price Sale price ¥270,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain AH187)

Uniprot NO.:B7HY84

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTFEQLIPLIIMAFALGMDAFSVSLGMGMMTLKIRQILYIGVTIGIFHIIMPFIGMVLGR FLSEQYGDIAHFAGAILLIGLGFYIVYSSILENEETRTAPIGISLFVFAFGVSIDSFSVG LSLGIYGAQTVITILLFGFISMLLAWTGLFIGRHAKGMLGTYGEIVGGIILVGFGLYLLF PI

Protein Names:Recommended name: UPF0059 membrane protein BCAH187_A5502

Gene Names:Ordered Locus Names:BCAH187_A5502

Expression Region:1-182

Sequence Info:full length protein

View full details