Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus Membrane protein insertase YidC 2(yidC2)

Recombinant Bacillus cereus Membrane protein insertase YidC 2(yidC2)

SKU:CSB-CF772206BAM

Regular price ¥283,000 JPY
Regular price Sale price ¥283,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain ATCC 14579 / DSM 31)

Uniprot NO.:Q814F4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CSETGQPITSKSTGIWNEYFVYPLSQLITYFADLFNSNYGLAIVITTLIIRFALLPLMIK QTKSTKAMQALQPEMVKLKEKYSSKDQATQQKLQQEMMQLYQKNGVNPLAGCLPIFVQMP ILFAFYHAIMRTAEIKQHSFLWFDLGHADPFYILPVVAAITTFIQQKLAMAGTAGQNPQM AMMLWLMPIMILIFAINFPAALSLYWVVGNIFGIAQMYFIKGPEIKASKAGKAGGSSK

Protein Names:Recommended name: Membrane protein insertase YidC 2 Alternative name(s): Foldase YidC 2 Membrane integrase YidC 2 Membrane protein YidC 2

Gene Names:Name:yidC2 Ordered Locus Names:BC_5488

Expression Region:21-258

Sequence Info:full length protein

View full details