Gene Bio Systems
Recombinant Bacillus cereus Membrane protein insertase YidC 1(yidC1)
Recombinant Bacillus cereus Membrane protein insertase YidC 1(yidC1)
SKU:CSB-CF800414BAM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bacillus cereus (strain ATCC 14579 / DSM 31)
Uniprot NO.:Q815V9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CSNAAPIDAHSTGIWDHYFVYPISFMIQFVAHHIPGASFGIAIIIMTLVIRSAMIPLAVS QYRSQAKMKKMQPELQKLKKKYGDVSKDLEKQKQYQKEMSELMKSGGWNPLAGCWPLLIQ MPIFSALYYAISRTEEIRTSSFLWVNLGHADPYHILPIIAALTTFIQMKVFQSNITPGEQ VQMLKMQQIMMPAMILFMGFAAPSGLVLYWITGNLFTMTQTIVLRKIMEREELQLQKA
Protein Names:Recommended name: Membrane protein insertase YidC 1 Alternative name(s): Foldase YidC 1 Membrane integrase YidC 1 Membrane protein YidC 1
Gene Names:Name:yidC1 Ordered Locus Names:BC_5016
Expression Region:23-260
Sequence Info:full length protein
