Recombinant Bacillus anthracis UPF0295 protein BAMEG_4067 (BAMEG_4067)

CSB-CF501692BQG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis (strain CDC 684 / NRRL 3495)

Uniprot NO.:C3LH93

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS

Protein Names:Recommended name: UPF0295 protein BAMEG_4067

Gene Names:Ordered Locus Names:BAMEG_4067

Expression Region:1-118

Sequence Info:full length protein