Skip to product information
1 of 1

Gene Bio Systems

Recombinant ATP synthase subunit C, organellar chromatophore(atpE)

Recombinant ATP synthase subunit C, organellar chromatophore(atpE)

SKU:CSB-CF540973ESL

Regular price ¥219,700 JPY
Regular price Sale price ¥219,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Paulinella chromatophora

Uniprot NO.:B1X3Y2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDLTSAASVLAAALAVGLAAIGPGIGQGTAAGSAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALVLLFANPFVK

Protein Names:Recommended name: ATP synthase subunit C, organellar chromatophore Alternative name(s): ATP synthase F0 sector subunit C ATPase subunit III Lipid-binding protein

Gene Names:Name:atpE Synonyms:atpH Ordered Locus Names:PCC_0201

Expression Region:1-82

Sequence Info:full length protein

View full details