Skip to product information
1 of 1

Gene Bio Systems

Recombinant ATP synthase protein I(atpI)

Recombinant ATP synthase protein I(atpI)

SKU:CSB-CF364630EGX

Regular price ¥261,900 JPY
Regular price Sale price ¥261,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O6

Uniprot NO.:P0ABC1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SVSLVSRNVARKLLLVQLLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWRH QAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPLIVTWVLVLVVQILAPAV INNKG

Protein Names:Recommended name: ATP synthase protein I

Gene Names:Name:atpI Ordered Locus Names:c4667

Expression Region:2-126

Sequence Info:full length protein

View full details