Gene Bio Systems
Recombinant ATP synthase lipid-binding protein, mitochondrial(Y82E9BR.3)
Recombinant ATP synthase lipid-binding protein, mitochondrial(Y82E9BR.3)
SKU:CSB-CF859386CXY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:Q9BKS0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLK QQLFSYAILGFALSEAMGLFCLTMGFMILFAL
Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATP synthase c subunit ATPase protein 9 ATPase subunit c
Gene Names:ORF Names:Y82E9BR.3
Expression Region:25-116
Sequence Info:full length protein
