Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aspergillus oryzae Cytochrome c oxidase assembly protein cox16, mitochondrial(cox16)

Recombinant Aspergillus oryzae Cytochrome c oxidase assembly protein cox16, mitochondrial(cox16)

SKU:CSB-CF651609DPA

Regular price ¥262,100 JPY
Regular price Sale price ¥262,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)

Uniprot NO.:Q2PIY2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TTASSSLGERIGETYRARLPKHPFLLFGFPFVMIIVAGSFALTPAAALRYERYDRKVQQL SQEEAMNLGLRGPDGEEGIKRNPRRRIIGDEREEYYRLMAKDLDNWEQKRVQRFKGEPDG KL

Protein Names:Recommended name: Cytochrome c oxidase assembly protein cox16, mitochondrial

Gene Names:Name:cox16 ORF Names:AO090206000015

Expression Region:13-134

Sequence Info:full length protein

View full details