Recombinant Ashbya gossypii V-type proton ATPase 16 kDa proteolipid subunit 2(VMA11)

SKU: CSB-CF741612DOT

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Uniprot NO.:Q755G4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDDLVNEYAPAFAPFFGFAGCAAAMILSSLGAAIGTAKSGIGISGIGTFRPELIMKSLI PVVMSGILAVYGLVVAVLVAGGLSPTEEYTLFNGFMHLAAGLCVGFACLSSGYAIGIVGD VGVRKFMHQPRLFVGIVLILIFAEVLGLYGMIIALILNTRGSGN

Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit 2 Short name= V-ATPase 16 kDa proteolipid subunit 2 Alternative name(s): Proteolipid protein VMA11 Vacuolar proton pump 16 kDa proteolipid subunit 2

Gene Names:Name:VMA11 Ordered Locus Names:AFL141C

Expression Region:1-164

Sequence Info:full length protein