Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ashbya gossypii Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit(ERI1)

Recombinant Ashbya gossypii Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit(ERI1)

SKU:CSB-CF748412DOT

Regular price ¥253,200 JPY
Regular price Sale price ¥253,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Uniprot NO.:Q75D30

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNDKVAATLVLVVTYSIVGASLWCLTYAWHDETKLYYWCIVQLLPVMLWVWCVISWCGAQ LFGYAKRGKAD

Protein Names:Recommended name: Phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit Alternative name(s): Endoplasmic reticulum-associated Ras inhibitor protein 1

Gene Names:Name:ERI1 Ordered Locus Names:ABR192C-A

Expression Region:1-71

Sequence Info:full length protein

View full details