Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ascaris suum Major pepsin inhibitor 3

Recombinant Ascaris suum Major pepsin inhibitor 3

SKU:CSB-EP322527DOS

Regular price ¥165,200 JPY
Regular price Sale price ¥165,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P19400

Gene Names: N/A

Organism: Ascaris suum (Pig roundworm) (Ascaris lumbricoides)

AA Sequence: QFLFSMSTGPFICTVKDNQVFVANLPWTMLEGDDIQVGKEFAARVEDCTNVKHDMAPTCTKPPPFCGPQDMKMFNFVGCSVLGNKLFIDQKYVRDLTAKDHAEVQTFREKIAAFEEQQENQPPSSGMPHGAVPAGGLSPPPPPSFCTVQ

Expression Region: 21-169aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 32.4 kDa

Alternative Name(s): Short name: PI-3

Relevance: This is an inhibitor of the aspartic protease pepsin.

Reference: "Molecular cloning, expression and characterization of an Ascaris inhibitor for pepsin and cathepsin E."Kageyama T.Eur. J. Biochem. 253:804-809(1998)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details