Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arthrobacter aurescens UPF0060 membrane protein AAur_4166 (AAur_4166)

Recombinant Arthrobacter aurescens UPF0060 membrane protein AAur_4166 (AAur_4166)

SKU:CSB-CF376801AUZ

Regular price ¥259,700 JPY
Regular price Sale price ¥259,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arthrobacter aurescens (strain TC1)

Uniprot NO.:A1RC71

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTILKTTILFVLAAVAEIGGAWLIWQAVREGKAWWWAGLGVVALGIYGFFAAFQPDAHFG RVLAAYGGVFIAGSLGWGMLMDGFRPDRWDVIGAAICIVGVGVIMFAPRPGG

Protein Names:Recommended name: UPF0060 membrane protein AAur_4166

Gene Names:Ordered Locus Names:AAur_4166

Expression Region:1-112

Sequence Info:full length protein

View full details