Recombinant Artemisia vulgaris Non-specific lipid-transfer protein

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Artemisia vulgaris Non-specific lipid-transfer protein

CSB-EP020856AOH
Regular price
¥117,500 JPY
Sale price
¥117,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P0C088

Gene Names: N/A

Organism: Artemisia vulgaris (Mugwort)

AA Sequence: ALTCSDVSNKISPCLSYLKQGGEVPADCCAGVKGLND

Expression Region: 1-37aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: NO-Tagged

MW: 3.8 kDa

Alternative Name(s): Pollen allergen Art v 3 Allergen: Art v 3

Relevance: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues

Reference: "Lipid-transfer proteins as potential plant panallergens: cross-reactivity among proteins of Artemisia pollen, Castanea nut and Rosaceae fruits, with different IgE-binding capacities." Diaz-Perales A., Lombardero M., Sanchez-Monge R., Garcia-Selles F.J., Pernas M., Fernandez-Rivas M., Barber D., Salcedo G. Clin. Exp. Allergy 30:1403-1410(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share