Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aromatoleum aromaticum Disulfide bond formation protein B(dsbB)

Recombinant Aromatoleum aromaticum Disulfide bond formation protein B(dsbB)

SKU:CSB-CF711880AAAB

Regular price ¥269,900 JPY
Regular price Sale price ¥269,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1))

Uniprot NO.:Q5P2Z1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQSFAFSTRALFLGLFAVCAGLLGFGLYLQHAVGLEPCPMCIMQRYAFVAIALTALVAGL HGPGRRGTRAYAAVILLLALAGGGVALRQTWMQLYPPEFAECGPDLEFMLGSFPLADALP MIFQGAGDCSKVDWAFLGLSIANWSLVCLTLVAVFAIMMIARKRGG

Protein Names:Recommended name: Disulfide bond formation protein B Alternative name(s): Disulfide oxidoreductase

Gene Names:Name:dsbB Ordered Locus Names:AZOSEA21980 ORF Names:ebA3876

Expression Region:1-166

Sequence Info:full length protein

View full details