Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arginine exporter protein ArgO(argO)

Recombinant Arginine exporter protein ArgO(argO)

SKU:CSB-CF852528YAS

Regular price ¥270,900 JPY
Regular price Sale price ¥270,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Yersinia pestis

Uniprot NO.:Q8ZHH6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLAVYLHGFILSAAMILPLGPQNVFVMNQGIKRQHHLMSASLCALSDIILICAGIFGGSA LLSRSPLLLALVTWGGVAFLMWYGWGALMAAWRGDGVASSATSVTQGRWRILVTLLAVTW LNPHVYLDTFVVLGSLGGQLLPDIRPWFALGAVTASIVWFFALALLAAWLSPWLNRPVAQ RIINLFVGGVMGFIAFQLARQGFGL

Protein Names:Recommended name: Arginine exporter protein ArgO

Gene Names:Name:argO Ordered Locus Names:YPO0918, y3305, YP_3522

Expression Region:1-205

Sequence Info:full length protein

View full details