Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arginine ABC transporter permease protein ArtM(artM)

Recombinant Arginine ABC transporter permease protein ArtM(artM)

SKU:CSB-CF360048EOD

Regular price ¥281,800 JPY
Regular price Sale price ¥281,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P0AE32

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFEYLPELMKGLHTSLTLTVASLIVALILALIFTIILTLKTPVLVWLVRGYITLFTGTPL LVQIFLIYYGPGQFPTLQEYPALWHLLSEPWLCALIALSLNSAAYTTQLFYGAIRAIPEG QWQSCSALGMSKKDTLAILLPYAFKRSLSSYSNEVVLVFKSTSLAYTITLMEVMGYSQLL YGRTYDVMVFGAAGIIYLVVNGLLTLMMRLIERKALAFERRN

Protein Names:Recommended name: Arginine ABC transporter permease protein ArtM

Gene Names:Name:artM Ordered Locus Names:Z1091, ECs0944

Expression Region:1-222

Sequence Info:full length protein

View full details