Gene Bio Systems
Recombinant Archaeoglobus fulgidus Putative cobalt transport protein CbiM(cbiM)
Recombinant Archaeoglobus fulgidus Putative cobalt transport protein CbiM(cbiM)
SKU:CSB-CF521612DOC
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Uniprot NO.:O29530
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHIMEGYLPPEWAAFWYVFAIPFLVYGALRVKRIIEEKPSMKSLIAVSAGFIFVLSALKL PSVTGSCSHPTGTGIAVVFFGPAVTALLSAIVLLYQALLLAHGGITTLGANTASMGVIGP FVGWIAFKLLKNVNFRVAVFAAAMLSDLVTYVVTSLQLALAFPSSAGVAGIIKSAATFMG IFAVTQVPLSIIEGVVAVMLVSYIFEVRSDVLEVVKA
Protein Names:Recommended name: Putative cobalt transport protein CbiM Alternative name(s): Energy-coupling factor transporter probable substrate-capture protein CbiM Short name= ECF transporter S component CbiM
Gene Names:Name:cbiM Ordered Locus Names:AF_0728
Expression Region:1-217
Sequence Info:full length protein
