Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana UPF0136 membrane protein At2g26240 (At2g26240)

Recombinant Arabidopsis thaliana UPF0136 membrane protein At2g26240 (At2g26240)

SKU:CSB-CF524640DOA

Regular price ¥224,400 JPY
Regular price Sale price ¥224,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O64847

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSSLSQKFTLAYASLLGVGGLMGYLKRGSKISLVAGGGSAALFYYVYTELPGNPVLASS IGIVGSAALTGMMGSRYLRTRKVVPAGLVSVVSLVMTGAYLHGLIRSS

Protein Names:Recommended name: UPF0136 membrane protein At2g26240

Gene Names:Ordered Locus Names:At2g26240 ORF Names:T1D16.12

Expression Region:1-108

Sequence Info:full length protein

View full details