Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00910 (AtMg00910)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00910 (AtMg00910)

SKU:CSB-CF309365DOA

Regular price ¥272,500 JPY
Regular price Sale price ¥272,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P92528

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPTANQLIRHGREEKRRTDRTEVLVFGLLVTRIIRFVHSVLFPIPVFCSIKVLLDYFCSL PIIDKLSKKWQLIWFYVLSVILCKSLFAVGYLWMDDLSRAISQFYPVVSGGLGGGNTPMP PTNPSEGGLLEGYYAHENEHSHDQQRGSPFWSKEYKESGSKRLFLNLEVEDQNTDTIGEQ VKAESGKCEKIKAKIIAKTHELLVSEDTKFQIKTI

Protein Names:Recommended name: Uncharacterized mitochondrial protein AtMg00910 Alternative name(s): ORF215a

Gene Names:Ordered Locus Names:AtMg00910

Expression Region:1-215

Sequence Info:full length protein

View full details